PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v1706540.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 328aa    MW: 38183.2 Da    PI: 5.4963
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v1706540.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.63.4e-5591381129
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                      +ppGfrFhPtdeelv +yL+kk++++k++l +vi+e+d+y++ePwdL +  ++   e++ewyfFs++dkky+tg+r+nrat +g+Wkatg+dk+
  Lj2g3v1706540.2   9 VPPGFRFHPTDEELVGYYLRKKIASQKIDL-DVIREIDLYRIEPWDLIErcRIGYeEQSEWYFFSHKDKKYPTGTRTNRATMAGFWKATGRDKA 101
                      69****************************.9***************743433332566*********************************** PP

              NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                      v++ k +l+g++ktLvfykgrap+g+ktdW+mheyrle
  Lj2g3v1706540.2 102 VYD-KMKLIGMRKTLVFYKGRAPNGQKTDWIMHEYRLE 138
                      ***.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-605158IPR003441NAC domain
PROSITE profilePS5100559.2619158IPR003441NAC domain
PfamPF023657.5E-2910137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:1990110Biological Processcallus formation
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MMESMESCVP PGFRFHPTDE ELVGYYLRKK IASQKIDLDV IREIDLYRIE PWDLIERCRI  60
GYEEQSEWYF FSHKDKKYPT GTRTNRATMA GFWKATGRDK AVYDKMKLIG MRKTLVFYKG  120
RAPNGQKTDW IMHEYRLETD ENGPPQEEGW VVCRAFKKKT TNSQTKTMEG WDSSYFYDEA  180
SVVSSVVDPL DLISRQPPQR FLAQSFMCKQ EIEAENLRHH MNPEQFIQLP QLESPSVPLM  240
KRPSTVVSLV SDNNNEDHDD QNRLLLSNKK VTDWRDLDKF VASQLSQETE GLPSFENHGG  300
SDMALFEGTK LSPFLSTSEI LTSLWLFN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-51616012170Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00266DAPTransfer from AT2G18060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1472741e-166BT147274.1 Medicago truncatula clone JCVI-FLMt-4I24 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007046735.10.0Vascular related NAC-domain protein 1 isoform 1
SwissprotQ9SL411e-150NAC37_ARATH; NAC domain-containing protein 37
TrEMBLA0A061DFT40.0A0A061DFT4_THECC; Vascular related NAC-domain protein 1 isoform 1
STRINGVIT_04s0023g03110.t011e-177(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.11e-148vascular related NAC-domain protein 1